PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G25790.1
Common NameF18A17.40, TCX7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family CPP
Protein Properties Length: 459aa    MW: 51357.2 Da    PI: 8.1515
Description Tesmin/TSO1-like CXC domain-containing protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G25790.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.71.3e-1493131241
          TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                  ++k+CnCk+skClk+YCeCfa+g++C+  C+C +C+Nk e
  AT5G25790.1  93 QQKHCNCKNSKCLKLYCECFASGSYCNG-CNCVNCHNKLE 131
                  79**************************.********987 PP

2TCR50.83.3e-16177216140
          TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                  k++kgC+C+ks ClkkYCeC++a+  Cse+C+C+dCkN e
  AT5G25790.1 177 KHSKGCHCRKSGCLKKYCECYQANILCSENCRCQDCKNFE 216
                  589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011148.7E-1792132IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.87593217IPR005172CRC domain
PfamPF036382.7E-1194129IPR005172CRC domain
SMARTSM011143.9E-19177218IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.8E-12180215IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 459 aa     Download sequence    Send to blast
MEDLSNQNLL PRQSDISIPA EKMDSFQKSL EPPPCSPVKS SQQSETEVTP PQKPPLHQFG  60
HNQVQKNRVS NQDPSTSRRH NEVESKENTP NKQQKHCNCK NSKCLKLYCE CFASGSYCNG  120
CNCVNCHNKL ENESSRQVAI SGILERNPDA FKPKIAGSPH GMKDLQENVQ QVLLIGKHSK  180
GCHCRKSGCL KKYCECYQAN ILCSENCRCQ DCKNFEGSEE RKALLHGSQV SDTYIQQMTN  240
AAVNRAIDMS AYLYPPESRK RKSKDISDSV VSSYGVQYQR ANHVRRNGEN SLFSLPNNKA  300
VSGSTTSAYR SSWSNTFQPH HVRELCSLLV SNSVDVANKL SDKGRKNDKG PSSLDGAQRV  360
ANEINDSPDC VLDANRMDEK PISPATRALM CDEEHEIGSE KETSARVKTS QEKEDTDTSS  420
GIYLEQERQI LSIFRDYLIQ LSNRARINGK NIKSNTNPS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1257262SRKRKS
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO795210020.0
Expression AtlasAT5G25790-
AtGenExpressAT5G25790-
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G25790.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G25790
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0054050.0AC005405.1 BAC F18A17 from chromosome V containing TINY at 60.5 cM, complete sequence.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_197951.20.0Tesmin/TSO1-like CXC domain-containing protein
SwissprotF4JY840.0TCX7_ARATH; Protein tesmin/TSO1-like CXC 7
TrEMBLR0HA940.0R0HA94_9BRAS; Uncharacterized protein (Fragment)
STRINGAT5G25790.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM134631628
Representative plantOGRP14691745
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Castelli V, et al.
    Whole genome sequence comparisons and "full-length" cDNA sequences: a combined approach to evaluate and improve Arabidopsis genome annotation.
    Genome Res., 2004. 14(3): p. 406-13
    [PMID:14993207]
  3. Andersen SU, et al.
    The conserved cysteine-rich domain of a tesmin/TSO1-like protein binds zinc in vitro and TSO1 is required for both male and female fertility in Arabidopsis thaliana.
    J. Exp. Bot., 2007. 58(13): p. 3657-70
    [PMID:18057042]